PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim09g005030.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 147aa    MW: 16633.9 Da    PI: 7.6416
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim09g005030.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.5e-3262115255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +rlrWtpeLH rFv+ave+LGG+++AtPk +l++m++kgL+++hvkSHLQ++R+
  Sopim09g005030.0.1  62 ARLRWTPELHLRFVHAVERLGGQDRATPKLVLQMMNIKGLSIAHVKSHLQMFRS 115
                         79***************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.95858118IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-3058116IPR009057Homeodomain-like
SuperFamilySSF466898.96E-1661117IPR009057Homeodomain-like
TIGRFAMsTIGR015576.0E-2362117IPR006447Myb domain, plants
PfamPF002492.8E-1063113IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MLEDSGETGC NSKTSCNFEN EVLEENDASS KFKDGGSSSE STLEESEKIK PCVRPYVRSK  60
MARLRWTPEL HLRFVHAVER LGGQDRATPK LVLQMMNIKG LSIAHVKSHL QMFRSKKTDD  120
QSQGIGHHHK LFMEGGDPNI FNMIQFP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754481e-141HG975448.1 Solanum pennellii chromosome ch09, complete genome.
GenBankHG9755211e-141HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015087329.11e-106PREDICTED: putative two-component response regulator ARR21
TrEMBLK4CPZ31e-101K4CPZ3_SOLLC; Uncharacterized protein
STRINGSolyc09g005030.1.11e-101(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43822141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-47G2-like family protein